[Home] [Server]

CoABind results for job CA000001 (your_protein)

  Submitted Sequence

>your_protein
AMIVGLGTDIAEIERVEKALARSGENFARRILTDSELEQFHASKQQGRFLAKRFAAKEAASKALGTGIAQGVTFHDFTIS
HDKLGKPLLILSGQAAELASQLQVENIHLSISDERHYAMATVILERR

  Predicted CoA-binding site by CoABind

No. Residue Binary Propensity score
1 A 0 0.0711
2 M 0 0.1479
3 I 0 0.1072
4 V 0 0.1466
5 G 0 0.2272
6 L 0 0.1051
7 G 0 0.1623
8 T 0 0.0613
9 D 1 0.7444
10 I 0 0.0671
11 A 0 0.0487
12 E 0 0.0385
13 I 0 0.0854
14 E 0 0.0684
15 R 0 0.1110
16 V 0 0.0536
17 E 0 0.0886
18 K 0 0.0437
19 A 0 0.0416
20 L 0 0.0358
21 A 0 0.0489
22 R 0 0.0894
23 S 0 0.0427
24 G 0 0.0452
25 E 0 0.0583
26 N 0 0.1074
27 F 0 0.0428
28 A 0 0.0088
29 R 0 0.0460
30 R 0 0.0632
31 I 0 0.0475
32 L 1 0.4489
33 T 0 0.0493
34 D 0 0.0369
35 S 0 0.0613
36 E 0 0.0751
37 L 0 0.0555
38 E 0 0.0583
39 Q 0 0.1083
40 F 0 0.0283
41 H 0 0.0225
42 A 0 0.0388
43 S 0 0.0749
44 K 0 0.1888
45 Q 0 0.1044
46 Q 0 0.1186
47 G 0 0.0444
48 R 0 0.0472
49 F 1 0.5406
50 L 0 0.1147
51 A 0 0.0794
52 K 0 0.0578
53 R 1 0.4220
54 F 1 0.4156
55 A 0 0.0605
56 A 0 0.0209
57 K 0 0.2423
58 E 1 0.6620
59 A 0 0.0512
60 A 0 0.1180
61 S 0 0.2360
62 K 1 0.8406
63 A 0 0.0459
64 L 0 0.0391
65 G 1 0.7214
66 T 0 0.1846
67 G 1 0.7566
68 I 1 0.5336
69 A 1 0.4483
70 Q 0 0.0388
71 G 0 0.1167
72 V 0 0.2555
73 T 0 0.0362
74 F 0 0.0963
75 H 0 0.0316
76 D 0 0.0645
77 F 0 0.0369
78 T 0 0.0447
79 I 0 0.0272
80 S 0 0.0234
81 H 0 0.1360
82 D 0 0.0257
83 K 0 0.0192
84 L 1 0.4535
85 G 1 0.8985
86 K 1 0.4685
87 P 1 0.8504
88 L 0 0.0551
89 L 0 0.0604
90 I 0 0.0740
91 L 0 0.0300
92 S 0 0.0294
93 G 0 0.0616
94 Q 0 0.2434
95 A 0 0.0703
96 A 0 0.0563
97 E 0 0.0347
98 L 0 0.0840
99 A 0 0.0373
100 S 0 0.0260
101 Q 0 0.0772
102 L 0 0.0661
103 Q 0 0.0472
104 V 0 0.0593
105 E 0 0.0327
106 N 0 0.0295
107 I 0 0.0325
108 H 0 0.0670
109 L 0 0.0551
110 S 1 0.4891
111 I 1 0.9123
112 S 1 0.9122
113 D 1 0.9099
114 E 0 0.0434
115 R 0 0.0484
116 H 0 0.0229
117 Y 0 0.0319
118 A 0 0.0683
119 M 0 0.0355
120 A 0 0.0692
121 T 0 0.0399
122 V 0 0.0514
123 I 0 0.0256
124 L 0 0.0153
125 E 0 0.0455
126 R 0 0.0520
127 R 0 0.0544

Download the text file of the predictions by:
CoABind
SVMpred
TemPred



Please cite the following article when you use the CoABind server:
  • Q. Meng, Z. Peng, J. Yang, CoABind: a novel algorithm for Coenzyme A (CoA)- and CoA derivatives-binding residues prediction, Bioinformatics, 34: 2598-2604 (2018).