[Home] [Server]

PepBind results for job PB000001 (your_protein)

  Submitted Sequence

>your_protein
MKLSKDTIAILKNFASINSGILLSQGKFIMTRAVNGTTYAEANISDEIDFDVALYDLNSFLSILSLVSDDAEISMHTDGN
IKIADTRSTVYWPAADKSTIVFPNKPIQFPVASVITEIKAEDLQQLLRVSRGLQIDTIAITNKDGKIVINGYNKVEDSGL
TRPKYSLTLTDYDGSNNFNFVINMANMKIQPGNYKVMLWGAGDKVAAKFESSQVSYVIAMEADSTHDF

  Predicted protein-peptide binding residues by PepBind

No. Residue Binary Propensity score
1 M 0 0.0559
2 K 0 0.0404
3 L 0 0.0528
4 S 0 0.0509
5 K 0 0.0644
6 D 0 0.0406
7 T 0 0.0517
8 I 0 0.0398
9 A 0 0.0379
10 I 0 0.0817
11 L 0 0.0629
12 K 0 0.0533
13 N 0 0.0837
14 F 0 0.0661
15 A 0 0.0409
16 S 0 0.0511
17 I 0 0.0541
18 N 0 0.0475
19 S 0 0.0499
20 G 0 0.0439
21 I 0 0.0385
22 L 0 0.0491
23 L 0 0.0390
24 S 0 0.0574
25 Q 0 0.0410
26 G 0 0.0344
27 K 0 0.0372
28 F 0 0.0478
29 I 0 0.0348
30 M 0 0.0698
31 T 0 0.0324
32 R 1 1.0000
33 A 0 0.0532
34 V 0 0.0406
35 N 1 1.0000
36 G 1 1.0000
37 T 1 1.0000
38 T 1 1.0000
39 Y 1 1.0000
40 A 0 0.0323
41 E 0 0.0493
42 A 0 0.0362
43 N 0 0.0393
44 I 0 0.0359
45 S 0 0.0593
46 D 0 0.0529
47 E 0 0.0626
48 I 0 0.0560
49 D 0 0.0470
50 F 0 0.0366
51 D 0 0.0664
52 V 0 0.0527
53 A 0 0.0462
54 L 0 0.0504
55 Y 0 0.0562
56 D 0 0.0475
57 L 0 0.0587
58 N 0 0.0533
59 S 0 0.0503
60 F 0 0.0754
61 L 0 0.0381
62 S 0 0.0407
63 I 0 0.0822
64 L 0 0.0727
65 S 0 0.0448
66 L 0 0.0548
67 V 0 0.0564
68 S 0 0.0540
69 D 0 0.0415
70 D 0 0.0445
71 A 0 0.0428
72 E 0 0.0375
73 I 0 0.0380
74 S 0 0.0442
75 M 0 0.0317
76 H 0 0.0322
77 T 0 0.0297
78 D 0 0.0412
79 G 0 0.0309
80 N 0 0.0388
81 I 0 0.0319
82 K 0 0.0472
83 I 0 0.0403
84 A 0 0.0453
85 D 0 0.0478
86 T 0 0.0273
87 R 0 0.0577
88 S 0 0.0300
89 T 0 0.0278
90 V 0 0.0240
91 Y 0 0.0216
92 W 0 0.0544
93 P 0 0.0432
94 A 0 0.0405
95 A 0 0.0284
96 D 0 0.0333
97 K 0 0.0687
98 S 0 0.0687
99 T 0 0.0390
100 I 0 0.0435
101 V 0 0.0400
102 F 0 0.0476
103 P 0 0.0407
104 N 1 1.0000
105 K 1 1.0000
106 P 0 0.0668
107 I 1 1.0000
108 Q 0 0.0644
109 F 0 0.0322
110 P 1 1.0000
111 V 0 0.0278
112 A 0 0.0369
113 S 0 0.0410
114 V 0 0.0470
115 I 0 0.0292
116 T 0 0.0323
117 E 0 0.0318
118 I 0 0.0379
119 K 0 0.0333
120 A 0 0.0334
121 E 0 0.0488
122 D 0 0.0403
123 L 0 0.0339
124 Q 0 0.0492
125 Q 0 0.0573
126 L 0 0.0454
127 L 0 0.0495
128 R 0 0.0642
129 V 0 0.0591
130 S 0 0.0412
131 R 0 0.0319
132 G 0 0.0480
133 L 0 0.0583
134 Q 0 0.0294
135 I 0 0.0301
136 D 0 0.0362
137 T 0 0.0227
138 I 0 0.0325
139 A 0 0.0357
140 I 0 0.0305
141 T 0 0.0373
142 N 0 0.0288
143 K 0 0.0403
144 D 0 0.0378
145 G 0 0.0244
146 K 0 0.0258
147 I 0 0.0276
148 V 0 0.0249
149 I 0 0.0265
150 N 0 0.0318
151 G 0 0.0166
152 Y 0 0.0391
153 N 0 0.0374
154 K 0 0.0230
155 V 0 0.0209
156 E 0 0.0335
157 D 0 0.0427
158 S 0 0.0396
159 G 0 0.0263
160 L 0 0.0400
161 T 0 0.0365
162 R 0 0.0560
163 P 0 0.0753
164 K 0 0.0487
165 Y 0 0.0717
166 S 0 0.1044
167 L 0 0.0572
168 T 0 0.0843
169 L 0 0.0361
170 T 0 0.0649
171 D 0 0.0592
172 Y 0 0.0715
173 D 0 0.0387
174 G 0 0.0476
175 S 0 0.0362
176 N 0 0.0476
177 N 0 0.0448
178 F 0 0.0852
179 N 0 0.0597
180 F 0 0.0583
181 V 0 0.0657
182 I 0 0.0564
183 N 0 0.0542
184 M 0 0.0389
185 A 0 0.0551
186 N 0 0.0537
187 M 0 0.0494
188 K 0 0.0509
189 I 0 0.0498
190 Q 0 0.0395
191 P 0 0.0380
192 G 0 0.0469
193 N 0 0.0615
194 Y 0 0.0641
195 K 0 0.0663
196 V 0 0.0461
197 M 0 0.0481
198 L 0 0.0368
199 W 0 0.0659
200 G 0 0.0318
201 A 0 0.0417
202 G 0 0.0513
203 D 0 0.0617
204 K 1 1.0000
205 V 1 1.0000
206 A 1 1.0000
207 A 0 0.0408
208 K 0 0.0425
209 F 0 0.0748
210 E 0 0.0462
211 S 0 0.0547
212 S 0 0.0388
213 Q 0 0.0458
214 V 0 0.0349
215 S 0 0.0454
216 Y 0 0.0839
217 V 1 1.0000
218 I 1 1.0000
219 A 1 1.0000
220 M 0 0.0412
221 E 1 1.0000
222 A 0 0.0538
223 D 0 0.0621
224 S 0 0.0530
225 T 0 0.0632
226 H 0 0.0534
227 D 0 0.0450
228 F 0 0.0518

Download the text file of the predictions by:
PepBind
SVMpep



Please cite the following article when you use the PepBind server:
  • Z. Zhao, Z. Peng, J. Yang, Improving sequence-based prediction of protein-peptide binding residues by introducing intrinsic disorder and a consensus method, Journal of Chemical Information and Modeling, 58: 1459-1468 (2018).