trRosetta results for job TR000001 (test)

[Click on TR000001_results.tar.bz2 to download the tarball file including all modeling results listed on this page]

   Predicted 1D Information
Sequence: --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------
123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|1234567
AMIVGLGTDIAEIERVEKALARSGENFARRILTDSELEQFHASKQQGRFLAKRFAAKEAASKALGTGIAQGVTFHDFTISHDKLGKPLLILSGQAAELASQLQVENIHLSISDERHYAMATVILERR
Sec_str: CCSSSSSSSSSSHHHHHHHHHHHCHHHHHHHCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCSSSSSSSSCCCCCCSSSSCHHHHHHHHHHCCCSSSSSSSCCCCSSSSSSSSSSC
Disorder: ...............................................................................................................................
H: Helix; S: Strand; C: Coil.
D: Disorder; .: Order
Download the multiple sequence alignment

   Predicted 2D Information
Download the predicted 2D information in npz format
Contact    Distance    Omega    Theta    Phi

   Predicted 3D Information

Download Model 1
Estimated TM-score: 0.844
  

Download Model 2
  
  

Download Model 3
  
  

Download Model 4
  
  

Download Model 5
  
  

Reference

  • J Yang, I Anishchenko, H Park, Z Peng, S Ovchinnikov, D Baker, Improved protein structure prediction using predicted interresidue orientations, PNAS, 117: 1496-1503 (2020)